diarioeducacion.com Website Traffic Check

recursos educativos para el desarrollo de aprendizajes significativos en educación primaria
Global Rank: 1,216,881/ -138,215
Country Rank: 44,864/ +6,331
Country: Mexico
Category Rank: 1,684/ +459
Category: science and education/education
Domain: Created by GoDaddy.com, LLC in 2011-12-16

  • Total Visits

    30.2K

  • Bounce Rate

    74.24%

  • Pages per Visit

    2.3

  • Avg Visit Duration

    00:01:49

diarioeducacion.com Ranking
Check if your rankings have improved or worsened over time. Over the last three months, diarioeducacion.com's global ranking has decreased from 872,103 to 1,216,881.
Similarly ranked sites
Global Country Category
diarioeducacion.com Traffic and Engagement
Website engagement metrics measure how much your website visitors are interacting with your website and online brand. diarioeducacion.com's traffic has decreased by -24.0% compared to last month.
Traffic & Engagement Last Month
Total Visits
30.2K
Last Month Change
-24.0%
Avg Visit Duration
00:01:49
Bounce Rate
74.24%
Pages per Visit
2.3
diarioeducacion.com Webpage Information
Page Title: Diario Educación |
Keywords: -
h1: 1
h2: 10
img: 10
script: 18
diarioeducacion.com Audience Demographics
Understanding social media demographics will help you fine-tune your marketing strategy and reach the right people with your message. diarioeducacion.com's audience is 48.15% male and 51.85% female. The largest age group of visitors are 25-34 year olds.
Similar Sites And diarioeducacion.com Competitors
Competitive Analysis is a foundation of digital marketing. If you know who your biggest competitors are, you can gather insights into what they do well and build your own strategy to outperform theirs. maestrosdeapoyo.com is the website with the highest similarity score to diarioeducacion.com.
Site Affinity Monthly visits Category Category rank
maestrosdeapoyo.com 100% - science and education/education -
concursonacional.sep.gob.mx 90.6% 5.3K science and education/education -
imageneseducativas.com 84.0% 1.3M science and education/education 1,489
actividadesdeinfantilyprimaria.com 83.4% 163.7K science and education/education 8,565
tudocente.com 83.3% 9.1K science and education/education 75,192
joelservando.com 83.3% 30.1K science and education/education 42,598
aprendeencasa.mx 81.9% 11.1K science and education/education 60,330
orientacionandujar.es 81.7% 1.0M science and education/education 1,587
ined21.com 81.6% 31.5K science and education/education 38,899
materialparamaestros.com 81.5% 203.9K science and education/education 7,054
diarioeducacion.com Traffic Sources Overview
Your website traffic data will show you where your traffic is coming from, how visitors engage with your site, and what digital marketing strategies are working. The main traffic sources for diarioeducacion.comare - and . An underutilized channel is "-".
diarioeducacion.com Top Keywords by Traffic Share
It's important to know what people are searching for and why. diarioeducacion.com's list of popular organic search keywords
actividades de lectura secundaria pdf ejercicios de divisiones con rompecabezas contenidos educación del plan 1993 fichero de español de primer grado libro de educacion artistica primer grado 2019-2020
GG
Social Media Traffic to diarioeducacion.com
Explore user journeys and pinpoint platforms that drive the most website traffic. diarioeducacion.com get's most of it's social media traffic from - and -. Engaging audiences through - may reveal new opportunities
diarioeducacion.com Referral Traffic & Outgoing Links
Referral Traffic
Sites that Referral traffic to diarioeducacion.com

    No Data to Display

GG
Outgoing Links
Sites that receive outbound traffic from diarioeducacion.com
diarioeducacion.com Geography & Country Targeting
For many businesses, it makes sense to target traffic from specific countries. Last month Mexico was the top country sending desktop traffic to diarioeducacion.com.
ADS
diarioeducacion.com Audience Interests
Identifying your target audience is the foundation of your marketing strategy. This helps you to understand who your target customer is and what they care about. diarioeducacion.com's audience is interested in social networks and online communities and file sharing and hosting.
Top Categories
social networks and online communities
file sharing and hosting
search engines
tv movies and streaming
Other Visited Websites
Top Topics
google
social network
community
facebook games
friends
Technology Stack
Instantly discover the technology stack used by any prospect or competitor to understand how their website works, which CMS or eCommerce platform they use, their communication tools of choice as well as analytics, hosting, advertising or internet technology usage.

Google Adsense

Google Analytics

Other popular tools

About diarioeducacion.com data description

We aim to get you a complete analysis of diarioeducacion.com. Get a full overview of diarioeducacion.com and its online visibility. Analyze diarioeducacion.com’s growth trend over time. Effortlessly Analyze Your Competitive Landscape. We will update diarioeducacion.com's data regularly to ensure you have the latest information.

ads