orientacionandujar.es Website Traffic Check

encuentra todos los recursos y materiales accesibles y gratuitos de educación y orientación.

Global Rank:	56,359/ -11,972
Country Rank:	3,797/ -1,105
Country:	Spain
Category Rank:	134/ +5
Category:	science and education/education
Domain:	-

Total Visits

1.0M
Bounce Rate

60.06%
Pages per Visit

3.2
Avg Visit Duration

00:02:45

orientacionandujar.es Ranking

Check if your rankings have improved or worsened over time. Over the last three months, orientacionandujar.es's global ranking has decreased from 40,976 to 56,359.

Similarly ranked sites

Global Country Category

orientacionandujar.es Traffic and Engagement

Website engagement metrics measure how much your website visitors are interacting with your website and online brand. orientacionandujar.es's traffic has decreased by -28.1% compared to last month.

Traffic & Engagement Last Month

Total Visits: 1.0M
Last Month Change: -28.1%
Avg Visit Duration: 00:02:45
Bounce Rate: 60.06%
Pages per Visit: 3.2

orientacionandujar.es Webpage Information

Page Title:	El portal de la educación - Orientación Andújar - Recursos Educativos
Keywords:	-

h1:	0
h2:	0

img:	19
script:	40

orientacionandujar.es Audience Demographics

Understanding social media demographics will help you fine-tune your marketing strategy and reach the right people with your message. orientacionandujar.es's audience is 38.18% male and 61.82% female. The largest age group of visitors are 25-34 year olds.

Similar Sites And orientacionandujar.es Competitors

Competitive Analysis is a foundation of digital marketing. If you know who your biggest competitors are, you can gather insights into what they do well and build your own strategy to outperform theirs. aulapt.org is the website with the highest similarity score to orientacionandujar.es.

Site	Affinity	Monthly visits	Category	Category rank
aulapt.org	100%	175.8K	science and education/education	8,057
imageneseducativas.com	92.5%	1.3M	science and education/education	1,489
actiludis.com	89.8%	170.0K	science and education/education	8,372
actividadesdeinfantilyprimaria.com	79.9%	163.7K	science and education/education	8,565
edufichas.com	72.4%	617.1K	science and education/education	2,717
escuelaenlanube.com	72.1%	82.1K	science and education/education	18,938
mundoprimaria.com	67.4%	2.4M	science and education/education	646
educapeques.com	67.1%	539.3K	science and education/education	3,916
wikisaber.es	64.2%	-	science and education/education	104,083
educaciontrespuntocero.com	63.9%	1.6M	science and education/education	1,469

orientacionandujar.es Traffic Sources Overview

Your website traffic data will show you where your traffic is coming from, how visitors engage with your site, and what digital marketing strategies are working. The main traffic sources for orientacionandujar.esare direct(13.74%) and referral(2.00%). An underutilized channel is "ads".

orientacionandujar.es Top Keywords by Traffic Share

It's important to know what people are searching for and why. orientacionandujar.es's list of popular organic search keywords

orientacion andujar taxonomia de bloom pdf horario de clases para pintar trisilabas cualidades positivas de un estudiante para la boleta de calificaciones

Social Media Traffic to orientacionandujar.es

Explore user journeys and pinpoint platforms that drive the most website traffic. orientacionandujar.es get's most of it's social media traffic from pinterest.com and facebook.com. Engaging audiences through youtube.com may reveal new opportunities

orientacionandujar.es Referral Traffic & Outgoing Links

Referral Traffic

Sites that Referral traffic to orientacionandujar.es

Outgoing Links

Sites that receive outbound traffic from orientacionandujar.es

orientacionandujar.es Geography & Country Targeting

For many businesses, it makes sense to target traffic from specific countries. Last month Spain was the top country sending desktop traffic to orientacionandujar.es.

ADS

orientacionandujar.es Audience Interests

Identifying your target audience is the foundation of your marketing strategy. This helps you to understand who your target customer is and what they care about. orientacionandujar.es's audience is interested in education and social networks and online communities.

Top Categories: education; social networks and online communities; search engines; programming and developer software; lottery

Other Visited Websites

Top Topics: google; google apps; más; social; recursos

Technology Stack

Instantly discover the technology stack used by any prospect or competitor to understand how their website works, which CMS or eCommerce platform they use, their communication tools of choice as well as analytics, hosting, advertising or internet technology usage.

Google Adsense

Google Analytics

Other popular tools

About orientacionandujar.es data description

We aim to get you a complete analysis of orientacionandujar.es. Get a full overview of orientacionandujar.es and its online visibility. Analyze orientacionandujar.es’s growth trend over time. Effortlessly Analyze Your Competitive Landscape. We will update orientacionandujar.es's data regularly to ensure you have the latest information.

ads